PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010558038.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB
Protein Properties Length: 569aa    MW: 62861.1 Da    PI: 5.174
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010558038.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.3e-184087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt Ed +l+d+vk++G g+W+++ ++ g+ R++k+c++rw ++l
   XP_010558038.1 40 KGPWTTAEDAILIDYVKKHGEGNWNAVQKYTGLSRCGKSCRLRWANHL 87
                     79******************************************9986 PP

2Myb_DNA-binding51.72e-1693136146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l++++++++G++ W++ a++++ gRt++++k++w++
   XP_010558038.1  93 KGAFSEEEEQLIIELHARMGNK-WARMAAHLP-GRTDNEIKNYWNT 136
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.513587IPR017930Myb domain
SMARTSM007171.4E-153989IPR001005SANT/Myb domain
SuperFamilySSF466891.46E-3039134IPR009057Homeodomain-like
PfamPF002493.2E-164087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-244194IPR009057Homeodomain-like
CDDcd001676.31E-124287No hitNo description
PROSITE profilePS5129425.97988142IPR017930Myb domain
SMARTSM007171.0E-1692140IPR001005SANT/Myb domain
PfamPF002491.1E-1593136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2595141IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MSHTTDESDD GMYSNHHNEA SGADIGSGCR SRWDGTVLKK GPWTTAEDAI LIDYVKKHGE  60
GNWNAVQKYT GLSRCGKSCR LRWANHLRPN LKKGAFSEEE EQLIIELHAR MGNKWARMAA  120
HLPGRTDNEI KNYWNTRIKR RQRAGLPLYP PEMHVEALQW NQEYTKTEII GPAKRHQDFL  180
QVGNCEPNVL FDSLKVVTGM VPSALDISDI PSCNILGNGA SSSQYKSFIP PLMQSPKRES  240
RSLFSGYCSN IKDEFLSPEE FQSSAQQKIS KSLGFSFPRD ADPPDGNQHY PDVINGSHTL  300
MDAIFPTSSK PSLGTVKSEL PSFQYPETNF DQWNAPSTLH SDLLESVDAY IQSPPPMGRT  360
ETDCYDSCNT GLLDTVLHEA KIRTGAKNGS FSSEKSFSSI TSPDIAAEGI THNDPETKYK  420
EFEGTTLEPL ANSKIPMSMQ LDAGGSSSGE SPSPTNSFAW DNVKMEQWDR IWMPERETNE  480
KTPLLDITRP DVLLASSWLD HGLGLGLAKE TTMSDALVAL LGNEFGNEYM HIAVGTSSSS  540
SSSSSGQAQA VGFCPWSNMP PVCQMTELP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-312914113127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010558038.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_010558039.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_010558040.10.0PREDICTED: transcription factor GAMYB-like isoform X1
TrEMBLD7LAN10.0D7LAN1_ARALL; Transcription factor
STRINGfgenesh2_kg.3__1182__AT3G11440.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.30.0myb domain protein 33